SCOPe 2.08: Domain d2xaga3: 2xag A:655-763

Lineage for d2xaga3 (2xag A:655-763)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)

6. Protein Lysine-specific histone demethylase 1, LSD1 [159953] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159954] (27 PDB entries)
   Uniprot O60341 655-763

8. Domain d2xaga3: 2xag A:655-763 [264569]
   Other proteins in same PDB: d2xaga1, d2xaga2, d2xagb1, d2xagb2
   complexed with fad, tcf

Details for d2xaga3

PDB Entry: 2xag, 3.1 Å

PDB Description: crystal structure of lsd1-corest in complex with para-bromo-(-)-trans-2-phenylcyclopropyl-1-amine

PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOPe Domain Sequences for d2xaga3:

Sequence; same for both SEQRES and ATOM records:

>d2xaga3 d.16.1.5 (A:655-763) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
gfgnlnkvvlcfdrvfwdpsvnlfghvgsttasrgelflfwnlykapillalvageaagi
menisddvivgrclailkgifgssavpqpketvvsrwradpwargsysy

Timeline for d2xaga3:

• d2xaga3 first appeared in SCOPe 2.05
  
• d2xaga3 appears in SCOPe 2.07