Lineage for d1bmff2 (1bmf F:9-81)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15612Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 15613Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 15614Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)
  6. 15615Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (3 species)
  7. 15619Species Cow (Bos taurus) [TaxId:9913] [50618] (7 PDB entries)
  8. 15637Domain d1bmff2: 1bmf F:9-81 [26451]
    Other proteins in same PDB: d1bmfa1, d1bmfa3, d1bmfb1, d1bmfb3, d1bmfc1, d1bmfc3, d1bmfd1, d1bmfd3, d1bmfe1, d1bmfe3, d1bmff1, d1bmff3, d1bmfg_

Details for d1bmff2

PDB Entry: 1bmf (more details), 2.85 Å

PDB Description: bovine mitochondrial f1-atpase

SCOP Domain Sequences for d1bmff2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmff2 b.49.1.1 (F:9-81) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOP Domain Coordinates for d1bmff2:

Click to download the PDB-style file with coordinates for d1bmff2.
(The format of our PDB-style files is described here.)

Timeline for d1bmff2: