Lineage for d2r7ad_ (2r7a D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2160864Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2160971Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2161281Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2161282Protein automated matches [190944] (35 species)
    not a true protein
  7. 2161362Species Shigella dysenteriae [TaxId:622] [267803] (2 PDB entries)
  8. 2161370Domain d2r7ad_: 2r7a D: [264498]
    automated match to d4m7oa_
    complexed with hem

Details for d2r7ad_

PDB Entry: 2r7a (more details), 2.05 Å

PDB Description: Crystal Structure of a Periplasmic Heme Binding Protein from Shigella dysenteriae
PDB Compounds: (D:) Bacterial heme binding protein

SCOPe Domain Sequences for d2r7ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r7ad_ c.92.2.0 (D:) automated matches {Shigella dysenteriae [TaxId: 622]}
aerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrpd
svitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvtq
inqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqyk
sysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgpr
iadvveslhqqlwpq

SCOPe Domain Coordinates for d2r7ad_:

Click to download the PDB-style file with coordinates for d2r7ad_.
(The format of our PDB-style files is described here.)

Timeline for d2r7ad_: