Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.92: Chelatase-like [53799] (3 superfamilies) duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) contains a long alpha helical insertion in the interdomain linker |
Family c.92.2.0: automated matches [191548] (1 protein) not a true family |
Protein automated matches [190944] (40 species) not a true protein |
Species Shigella dysenteriae [TaxId:622] [267803] (2 PDB entries) |
Domain d2r7ac_: 2r7a C: [264497] automated match to d4m7oa_ complexed with hem |
PDB Entry: 2r7a (more details), 2.05 Å
SCOPe Domain Sequences for d2r7ac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r7ac_ c.92.2.0 (C:) automated matches {Shigella dysenteriae [TaxId: 622]} aerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrpd svitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvtq inqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqyk sysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgpr iadvveslhqqlwpq
Timeline for d2r7ac_: