Lineage for d2qr7a_ (2qr7 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2222093Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2222094Protein automated matches [190417] (25 species)
    not a true protein
  7. 2223590Species Mouse (Mus musculus) [TaxId:10090] [194605] (24 PDB entries)
  8. 2223596Domain d2qr7a_: 2qr7 A: [264490]
    automated match to d4nifa_
    complexed with na

Details for d2qr7a_

PDB Entry: 2qr7 (more details), 2 Å

PDB Description: 2.0a x-ray structure of c-terminal kinase domain of p90 ribosomal s6 kinase 2: se-met derivative
PDB Compounds: (A:) Ribosomal protein S6 kinase alpha-3

SCOPe Domain Sequences for d2qr7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qr7a_ d.144.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qftdgyevkedigvgsysvckrcihkatnmefavkiidkskrdpteeieillrygqhpni
itlkdvyddgkyvyvvtelmkggelldkilrqkffsereasavlftitktveylhaqgvv
hrdlkpsnilyvdesgnpesiricdfgfakqlraengllmtpcytanfvapevlerqgyd
aacdiwslgvllytmltgytpfangpddtpeeilarigsgkfslsggywnsvsdtakdlv
skmlhvdphqrltaalvlrhpwivhwdqlpqyqlnrqdaphlvkgamaatysalnrnq

SCOPe Domain Coordinates for d2qr7a_:

Click to download the PDB-style file with coordinates for d2qr7a_.
(The format of our PDB-style files is described here.)

Timeline for d2qr7a_: