Class b: All beta proteins [48724] (180 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (51 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries) |
Domain d2qqoa3: 2qqo A:434-595 [264486] Other proteins in same PDB: d2qqoa1, d2qqob1 automated match to d2qqma2 complexed with ca, edo, trs |
PDB Entry: 2qqo (more details), 2.3 Å
SCOPe Domain Sequences for d2qqoa3:
Sequence, based on SEQRES records: (download)
>d2qqoa3 b.18.1.0 (A:434-595) automated matches {Human (Homo sapiens) [TaxId: 9606]} csnmlgmlsgliadsqisasstqeylwspsaarlvssrsgwfpripqaqpgeewlqvdlg tpktvkgviiqgarggdsitavearafvrkfkvsyslngkdweyiqdprtqqpklfegnm hydtpdirrfdpipaqyvrvyperwspagigmrlevlgcdwt
>d2qqoa3 b.18.1.0 (A:434-595) automated matches {Human (Homo sapiens) [TaxId: 9606]} csnmlgmlsgliadsqisasstqeylwspsaarlvssrsgwfpripqaqpgeewlqvdlg tpktvkgviiqgarggitavearafvrkfkvsyslngkdweyiqdprtqqpklfegnmhy dtpdirrfdpipaqyvrvyperwspagigmrlevlgcdwt
Timeline for d2qqoa3: