Class b: All beta proteins [48724] (174 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) automatically mapped to Pfam PF02874 |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries) Uniprot P19483 |
Domain d1bmfc2: 1bmf C:19-94 [26448] Other proteins in same PDB: d1bmfa1, d1bmfa3, d1bmfb1, d1bmfb3, d1bmfc1, d1bmfc3, d1bmfd1, d1bmfd2, d1bmfd3, d1bmfe1, d1bmfe2, d1bmfe3, d1bmff1, d1bmff2, d1bmff3, d1bmfg_ complexed with adp, anp, mg |
PDB Entry: 1bmf (more details), 2.85 Å
SCOPe Domain Sequences for d1bmfc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bmfc2 b.49.1.1 (C:19-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} adtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgn dklikegdivkrtgai
Timeline for d1bmfc2: