Lineage for d1bmfa2 (1bmf A:24-94)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2067173Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 2067174Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2067175Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 2067176Protein F1 ATP synthase alpha subunit, domain 1 [88672] (5 species)
  7. 2067195Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries)
    Uniprot P19483
  8. 2067220Domain d1bmfa2: 1bmf A:24-94 [26446]
    Other proteins in same PDB: d1bmfa1, d1bmfa3, d1bmfb1, d1bmfb3, d1bmfc1, d1bmfc3, d1bmfd1, d1bmfd2, d1bmfd3, d1bmfe1, d1bmfe2, d1bmfe3, d1bmff1, d1bmff2, d1bmff3, d1bmfg_
    complexed with adp, anp, mg

Details for d1bmfa2

PDB Entry: 1bmf (more details), 2.85 Å

PDB Description: bovine mitochondrial f1-atpase
PDB Compounds: (A:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1bmfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmfa2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

SCOPe Domain Coordinates for d1bmfa2:

Click to download the PDB-style file with coordinates for d1bmfa2.
(The format of our PDB-style files is described here.)

Timeline for d1bmfa2: