Lineage for d1e1rf2 (1e1r F:9-81)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 803679Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 803680Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 803681Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 803734Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)
  7. 803737Species Cow (Bos taurus) [TaxId:9913] [88678] (12 PDB entries)
    Uniprot P00829
  8. 803755Domain d1e1rf2: 1e1r F:9-81 [26445]
    Other proteins in same PDB: d1e1ra1, d1e1ra2, d1e1ra3, d1e1rb1, d1e1rb2, d1e1rb3, d1e1rc1, d1e1rc2, d1e1rc3, d1e1rd1, d1e1rd3, d1e1re1, d1e1re3, d1e1rf1, d1e1rf3, d1e1rg_
    complexed with adp, af3, anp, mg, po4

Details for d1e1rf2

PDB Entry: 1e1r (more details), 2.5 Å

PDB Description: bovine mitochondrial f1-atpase inhibited by mg2+adp and aluminium fluoride
PDB Compounds: (F:) bovine mitochondrial f1-ATPase

SCOP Domain Sequences for d1e1rf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1rf2 b.49.1.1 (F:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOP Domain Coordinates for d1e1rf2:

Click to download the PDB-style file with coordinates for d1e1rf2.
(The format of our PDB-style files is described here.)

Timeline for d1e1rf2: