Class b: All beta proteins [48724] (174 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) automatically mapped to Pfam PF02874 |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species) |
Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries) Uniprot P19483 |
Domain d1e1rc2: 1e1r C:19-94 [26442] Other proteins in same PDB: d1e1ra1, d1e1ra3, d1e1rb1, d1e1rb3, d1e1rc1, d1e1rc3, d1e1rd1, d1e1rd2, d1e1rd3, d1e1re1, d1e1re2, d1e1re3, d1e1rf1, d1e1rf2, d1e1rf3, d1e1rg_ complexed with adp, af3, anp, mg, po4 |
PDB Entry: 1e1r (more details), 2.5 Å
SCOPe Domain Sequences for d1e1rc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e1rc2 b.49.1.1 (C:19-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} adtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgn dklikegdivkrtgai
Timeline for d1e1rc2: