Lineage for d2lxca_ (2lxc A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1892545Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1893753Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1893754Protein automated matches [190233] (11 species)
    not a true protein
  7. 1893765Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193300] (5 PDB entries)
  8. 1893772Domain d2lxca_: 2lxc A: [264379]
    automated match to d2dzia_

Details for d2lxca_

PDB Entry: 2lxc (more details)

PDB Description: Solution structure of the complex between the Sgt2 homodimerization domain and the Get5 UBL domain
PDB Compounds: (A:) ubiquitin-like protein mdy2

SCOPe Domain Sequences for d2lxca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lxca_ d.15.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mvhltlkkiqapkfsiehdfspsdtilqikqhliseekashiseiklllkgkvlhdnlfl
sdlkvtpanstitvmikpnle

SCOPe Domain Coordinates for d2lxca_:

Click to download the PDB-style file with coordinates for d2lxca_.
(The format of our PDB-style files is described here.)

Timeline for d2lxca_: