Lineage for d2lcva_ (2lcv A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2709316Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2709317Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2709766Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. 2709767Protein automated matches [190907] (21 species)
    not a true protein
  7. 2709846Species Escherichia coli [TaxId:362663] [255416] (2 PDB entries)
  8. 2709847Domain d2lcva_: 2lcv A: [264370]
    automated match to d2l8na_

Details for d2lcva_

PDB Entry: 2lcv (more details)

PDB Description: structure of the cytidine repressor dna-binding domain; an alternate calculation
PDB Compounds: (A:) HTH-type transcriptional repressor CytR

SCOPe Domain Sequences for d2lcva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lcva_ a.35.1.0 (A:) automated matches {Escherichia coli [TaxId: 362663]}
aatmkdvalkakvstatvsralmnpdkvsqatrnrvekaarevgylp

SCOPe Domain Coordinates for d2lcva_:

Click to download the PDB-style file with coordinates for d2lcva_.
(The format of our PDB-style files is described here.)

Timeline for d2lcva_: