SCOPe 2.05: Domain d2kxha2: 2kxh A:201-297

Lineage for d2kxha2 (2kxh A:201-297)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (74 PDB entries)

8. Domain d2kxha2: 2kxh A:201-297 [264365]
   automated match to d2mpua_

Details for d2kxha2

PDB Entry: 2kxh

PDB Description: solution structure of the first two rrm domains of fir in the complex with fbp nbox peptide

PDB Compounds: (A:) Poly(U)-binding-splicing factor PUF60

SCOPe Domain Sequences for d2kxha2:

Sequence; same for both SEQRES and ATOM records:

>d2kxha2 d.58.7.0 (A:201-297) automated matches {Human (Homo sapiens) [TaxId: 9606]}
laeearafnriyvasvhqdlsdddiksvfeafgkiksctlardpttgkhkgygfieyeka
qssqdavssmnlfdlggqylrvgkavtppmplltpat

Timeline for d2kxha2:

• d2kxha2 is new in SCOPe 2.05-stable
  
• d2kxha2 appears in SCOPe 2.06
  
• d2kxha2 appears in the current release, SCOPe 2.08