SCOP 1.61: Domain d1e79c2: 1e79 C:19-94

Lineage for d1e79c2 (1e79 C:19-94)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)

6. Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries)

8. Domain d1e79c2: 1e79 C:19-94 [26436]
   Other proteins in same PDB: d1e79a1, d1e79a3, d1e79b1, d1e79b3, d1e79c1, d1e79c3, d1e79d1, d1e79d3, d1e79e1, d1e79e3, d1e79f1, d1e79f3, d1e79g_, d1e79h1, d1e79h2, d1e79i_

Details for d1e79c2

PDB Entry: 1e79, 2.4 Å

PDB Description: Bovine F1-ATPase inhibited by DCCD (dicyclohexylcarbodiimide)

SCOP Domain Sequences for d1e79c2:

Sequence; same for both SEQRES and ATOM records:

>d1e79c2 b.49.1.1 (C:19-94) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
adtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgn
dklikegdivkrtgai

Timeline for d1e79c2:

• d1e79c2 first appeared (with stable ids) in SCOP 1.55
  
• d1e79c2 appears in SCOP 1.59
  
• d1e79c2 appears in SCOP 1.63
  
• d1e79c2 appears in the current release, SCOPe 2.08