Lineage for d2kbfa_ (2kbf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871683Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (15 PDB entries)
  8. 2871711Domain d2kbfa_: 2kbf A: [264347]
    automated match to d3gfpa_
    protein/RNA complex

Details for d2kbfa_

PDB Entry: 2kbf (more details)

PDB Description: solution structure of carboxyl-terminal domain of dbp5p
PDB Compounds: (A:) ATP-dependent RNA helicase DBP5

SCOPe Domain Sequences for d2kbfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kbfa_ c.37.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tnevnvdaikqlymdckneadkfdvltelyglmtigssiifvatkktanvlygklksegh
evsilhgdlqtqerdrliddfregrskvlittnvlargidiptvsmvvnydlptlangqa
dpatyihrigrtgrfgrkgvaisfvhdknsfnilsaiqkyfgdiemtrvptddwdeveki
vkkvlkd

SCOPe Domain Coordinates for d2kbfa_:

Click to download the PDB-style file with coordinates for d2kbfa_.
(The format of our PDB-style files is described here.)

Timeline for d2kbfa_: