SCOP 1.65: Domain d1e79a2: 1e79 A:19-94

Lineage for d1e79a2 (1e79 A:19-94)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88673] (10 PDB entries)

8. Domain d1e79a2: 1e79 A:19-94 [26434]
   Other proteins in same PDB: d1e79a1, d1e79a3, d1e79b1, d1e79b3, d1e79c1, d1e79c3, d1e79d1, d1e79d2, d1e79d3, d1e79e1, d1e79e2, d1e79e3, d1e79f1, d1e79f2, d1e79f3, d1e79g_, d1e79h1, d1e79h2, d1e79i_

Details for d1e79a2

PDB Entry: 1e79, 2.4 Å

PDB Description: Bovine F1-ATPase inhibited by DCCD (dicyclohexylcarbodiimide)

SCOP Domain Sequences for d1e79a2:

Sequence; same for both SEQRES and ATOM records:

>d1e79a2 b.49.1.1 (A:19-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus)}
adtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgn
dklikegdivkrtgai

Timeline for d1e79a2:

• d1e79a2 first appeared (with stable ids) in SCOP 1.55
  
• d1e79a2 appears in SCOP 1.63
  
• d1e79a2 appears in SCOP 1.67
  
• d1e79a2 appears in the current release, SCOPe 2.08