SCOPe 2.06: Domain d2jema_: 2jem A:

Lineage for d2jema_ (2jem A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (53 species)
   not a true protein

7. Species Bacillus licheniformis [TaxId:1402] [255255] (2 PDB entries)

8. Domain d2jema_: 2jem A: [264326]
   automated match to d2jena_

Details for d2jema_

PDB Entry: 2jem, 1.78 Å

PDB Description: native family 12 xyloglucanase from bacillus licheniformis

PDB Compounds: (A:) endo-beta-1,4-glucanase

SCOPe Domain Sequences for d2jema_:

Sequence; same for both SEQRES and ATOM records:

>d2jema_ b.29.1.0 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
asssnpsdklyfknkkyyifnnvwgadqvsgwwqtiyhnsdsdmgwvwnwpsntstvkay
psivsgwhwtegytagsgfptrlsdqknintkvsysisangtynaaydiwlhntnkaswd
saptdqimiwlnntnagpagsyvetvsigghswkvykgyidagggkgwnvfsfirtantq
sanlnirdftnyladskqwlsktkyvssvefgtevfggtgqinisnwdvtvr

Timeline for d2jema_:

• d2jema_ first appeared in SCOPe 2.05
  
• d2jema_ appears in SCOPe 2.07
  
• d2jema_ appears in the current release, SCOPe 2.08