Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.0: automated matches [191381] (1 protein) not a true family |
Protein automated matches [190475] (10 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [267784] (1 PDB entry) |
Domain d2j16a_: 2j16 A: [264320] automated match to d2g6zb_ complexed with mg, so4 |
PDB Entry: 2j16 (more details), 2.7 Å
SCOPe Domain Sequences for d2j16a_:
Sequence, based on SEQRES records: (download)
>d2j16a_ c.45.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ypkgpllvlpekiylyseptvkellpfdvvinvaeeandlrmqvpaveyhhyrwehdsqi aldlpsltsiihaattkrekilihcqcglsrsatliiayimkyhnlslrhsydllksrad kinpsiglifqlmewevalnak
>d2j16a_ c.45.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ypkgpllvlpekiylyseptvkellpfdvvinvaeeaaveyhhyrwehdsqialdlpslt siihaattkrekilihcqcglsrsatliiayimkyhnlslrhsydllksradkinpsigl ifqlmewevalnak
Timeline for d2j16a_: