Lineage for d2iepb1 (2iep B:25-118)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2035535Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (8 PDB entries)
  8. 2035544Domain d2iepb1: 2iep B:25-118 [264314]
    automated match to d4c4ko_
    complexed with so4

Details for d2iepb1

PDB Entry: 2iep (more details), 2.21 Å

PDB Description: crystal structure of immunoglobulin-like domains 1 and 2 of the receptor tyrosine kinase musk
PDB Compounds: (B:) Muscle-specific kinase receptor

SCOPe Domain Sequences for d2iepb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iepb1 b.1.1.0 (B:25-118) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
pkapvittpletvdalveevatfmcavesypqpeiswtrnkiliklfdtrysirengqll
tilsvedsddgiycctanngvggavescgalqvk

SCOPe Domain Coordinates for d2iepb1:

Click to download the PDB-style file with coordinates for d2iepb1.
(The format of our PDB-style files is described here.)

Timeline for d2iepb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iepb2