SCOPe 2.05: Domain d2e6pa_: 2e6p A:

Lineage for d2e6pa_ (2e6p A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d2e6pa_: 2e6p A: [264266]
   automated match to d2edfa_

Details for d2e6pa_

PDB Entry: 2e6p

PDB Description: solution structure of the ig-like domain (714-804) from human obscurin-like protein 1

PDB Compounds: (A:) Obscurin-like protein 1

SCOPe Domain Sequences for d2e6pa_:

Sequence; same for both SEQRES and ATOM records:

>d2e6pa_ b.1.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgpvhilspqdkvsltfttservvltcelsrvdfpatwykdgqkveesellvvkm
dgrkhrlilpeakvqdsgefecrtegvsaffgvtvqdpsgpssg

Timeline for d2e6pa_:

• d2e6pa_ is new in SCOPe 2.05-stable
  
• d2e6pa_ is called d2e6pa1 in SCOPe 2.06
  
• d2e6pa_ appears in the current release, SCOPe 2.08, called d2e6pa1