SCOPe 2.06: Domain d2dvlb2: 2dvl B:222-372

Lineage for d2dvlb2 (2dvl B:222-372)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (26 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [267776] (1 PDB entry)

8. Domain d2dvlb2: 2dvl B:222-372 [264264]
   Other proteins in same PDB: d2dvla1, d2dvlb1
   automated match to d4l1fa2
   complexed with fad

Details for d2dvlb2

PDB Entry: 2dvl, 2.5 Å

PDB Description: Crystal structure of project TT0160 from Thermus thermophilus HB8

PDB Compounds: (B:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d2dvlb2:

Sequence; same for both SEQRES and ATOM records:

>d2dvlb2 a.29.3.0 (B:222-372) automated matches {Thermus thermophilus [TaxId: 300852]}
grglayalagldsgrvgvaaqavgiargafeiakayaeereqfgkklkehqaiafkiadm
hvkiaaaralvleaarkkdrgerftleasaaklfasaaavevtreavqvlggygyhrdyr
veryyrdakvteiyegtseiqrlviarelyr

Timeline for d2dvlb2:

• d2dvlb2 first appeared in SCOPe 2.05
  
• d2dvlb2 appears in SCOPe 2.07
  
• d2dvlb2 appears in the current release, SCOPe 2.08