Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
Protein automated matches [226934] (25 species) not a true protein |
Species Thermus thermophilus [TaxId:300852] [267775] (1 PDB entry) |
Domain d2dvlb1: 2dvl B:3-221 [264263] Other proteins in same PDB: d2dvla2, d2dvlb2 automated match to d4l1fa1 complexed with fad |
PDB Entry: 2dvl (more details), 2.5 Å
SCOPe Domain Sequences for d2dvlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dvlb1 e.6.1.0 (B:3-221) automated matches {Thermus thermophilus [TaxId: 300852]} ltqeqrlvldavrrvarevlyplapeydrkaeypwpqlkalaelgllgmttpeewggvgl dsvtwalaleelaaadpsvavivsvtsglpqymllrfgseaqkrrylvplargewigafc ltepqagsdakslraearrvkggfvlngvkswitsaghahlyvvmartekgisaflvekg tpglsfgrpeekmglhaahtaevrleevfvpeenllgee
Timeline for d2dvlb1: