Lineage for d2dvla1 (2dvl A:3-221)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2246106Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily)
    2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology
  4. 2246107Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) (S)
    flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles)
  5. 2246252Family e.6.1.0: automated matches [227203] (1 protein)
    not a true family
  6. 2246253Protein automated matches [226934] (25 species)
    not a true protein
  7. 2246415Species Thermus thermophilus [TaxId:300852] [267775] (1 PDB entry)
  8. 2246416Domain d2dvla1: 2dvl A:3-221 [264261]
    Other proteins in same PDB: d2dvla2, d2dvlb2
    automated match to d4l1fa1
    complexed with fad

Details for d2dvla1

PDB Entry: 2dvl (more details), 2.5 Å

PDB Description: Crystal structure of project TT0160 from Thermus thermophilus HB8
PDB Compounds: (A:) acyl-CoA dehydrogenase

SCOPe Domain Sequences for d2dvla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dvla1 e.6.1.0 (A:3-221) automated matches {Thermus thermophilus [TaxId: 300852]}
ltqeqrlvldavrrvarevlyplapeydrkaeypwpqlkalaelgllgmttpeewggvgl
dsvtwalaleelaaadpsvavivsvtsglpqymllrfgseaqkrrylvplargewigafc
ltepqagsdakslraearrvkggfvlngvkswitsaghahlyvvmartekgisaflvekg
tpglsfgrpeekmglhaahtaevrleevfvpeenllgee

SCOPe Domain Coordinates for d2dvla1:

Click to download the PDB-style file with coordinates for d2dvla1.
(The format of our PDB-style files is described here.)

Timeline for d2dvla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dvla2