SCOPe 2.05: Domain d2dgoa_: 2dgo A:

Lineage for d2dgoa_ (2dgo A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226227] (5 PDB entries)

8. Domain d2dgoa_: 2dgo A: [264253]
   automated match to d2dgua_

Details for d2dgoa_

PDB Entry: 2dgo

PDB Description: solution structure of the rna binding domain in cytotoxic granule- associated rna binding protein 1

PDB Compounds: (A:) Cytotoxic granule-associated RNA binding protein 1

SCOPe Domain Sequences for d2dgoa_:

Sequence; same for both SEQRES and ATOM records:

>d2dgoa_ d.58.7.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgqkkdtsnhfhvfvgdlspeittedikaafapfgrisdarvvkdmatgkskgyg
fvsffnkwdaenaiqqmggqwlggrqirtnwatrkppapkstyesntkqsgpssg

Timeline for d2dgoa_:

• d2dgoa_ is new in SCOPe 2.05-stable
  
• d2dgoa_ is called d2dgoa1 in SCOPe 2.06
  
• d2dgoa_ appears in the current release, SCOPe 2.08, called d2dgoa1