SCOPe 2.08: Domain d1z2qa1: 1z2q A:7-84

Lineage for d1z2qa1 (1z2q A:7-84)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.0: automated matches [191482] (1 protein)
   not a true family

6. Protein automated matches [190772] (6 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [267770] (1 PDB entry)

8. Domain d1z2qa1: 1z2q A:7-84 [264229]
   Other proteins in same PDB: d1z2qa2
   automated match to d3t7la_

Details for d1z2qa1

PDB Entry: 1z2q

PDB Description: high-resolution solution structure of the lm5-1 fyve domain from leishmania major

PDB Compounds: (A:) lm5-1

SCOPe Domain Sequences for d1z2qa1:

Sequence; same for both SEQRES and ATOM records:

>d1z2qa1 g.50.1.0 (A:7-84) automated matches {Leishmania major [TaxId: 5664]}
gekqskgywqededapacngcgcvftttvrrhhcrncgyvlcgdcsrhraaipmrgitep
ervcdacylalrssnmag

Timeline for d1z2qa1:

• d1z2qa1 first appeared in SCOPe 2.05, called d1z2qa_
  
• d1z2qa1 appears in SCOPe 2.07