Lineage for d1wyna_ (1wyn A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1734996Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 1734997Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 1735075Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 1735076Protein automated matches [226856] (2 species)
    not a true protein
  7. 1735077Species Human (Homo sapiens) [TaxId:9606] [224978] (26 PDB entries)
  8. 1735132Domain d1wyna_: 1wyn A: [264205]
    automated match to d1wypa_

Details for d1wyna_

PDB Entry: 1wyn (more details)

PDB Description: Solution structure of the CH domain of human calponin-2
PDB Compounds: (A:) Calponin-2

SCOPe Domain Sequences for d1wyna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wyna_ a.40.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gssgssgnrllskydpqkeaelrtwiegltglsigpdfqkglkdgtilctlmnklqpgsv
pkinrsmqnwhqlenlsnfikamvsygmnpvdlfeandlfesgnmtqvqvsllalagkak
tkglqsgvdigvkysekqersgpssg

SCOPe Domain Coordinates for d1wyna_:

Click to download the PDB-style file with coordinates for d1wyna_.
(The format of our PDB-style files is described here.)

Timeline for d1wyna_: