Lineage for d1bt7__ (1bt7 -)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167857Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 167858Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 168698Family b.47.1.3: Viral proteases [50596] (2 proteins)
  6. 168699Protein NS3 protease [50600] (2 species)
  7. 168704Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (10 PDB entries)
  8. 168723Domain d1bt7__: 1bt7 - [26418]

Details for d1bt7__

PDB Entry: 1bt7 (more details)

PDB Description: the solution nmr structure of the n-terminal protease domain of the hepatitis c virus (hcv) ns3-protein, from bk strain, 20 structures

SCOP Domain Sequences for d1bt7__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bt7__ b.47.1.3 (-) NS3 protease {Human hepatitis C virus (HCV), different isolates}
tgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsktlagpkgpitqmytnvdqd
lvgwqappgarsltpctcgssdlylvtrhadvipvrrrgdsrgsllsprpvsylkgssgg
pllcpsghavgifraavctrgvakavdfvpvesmettmraskkkk

SCOP Domain Coordinates for d1bt7__:

Click to download the PDB-style file with coordinates for d1bt7__.
(The format of our PDB-style files is described here.)

Timeline for d1bt7__: