SCOP 1.69: Domain d1dxwa_: 1dxw A:

Lineage for d1dxwa_ (1dxw A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (4 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein NS3 protease [50600] (2 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (11 PDB entries)

8. Domain d1dxwa_: 1dxw A: [26417]

Details for d1dxwa_

PDB Entry: 1dxw

PDB Description: structure of hetero complex of non structural protein (ns) of hepatitis c virus (hcv) and synthetic peptidic compound

SCOP Domain Sequences for d1dxwa_:

Sequence; same for both SEQRES and ATOM records:

>d1dxwa_ b.47.1.3 (A:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
tgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsktlagpkgpitqmytnvdqd
lvgwqappgarsltpctcgssdlylvtrhadvipvrrrgdsrgsllsprpvsylkgssgg
pllcpsghavgifraavctrgvakavdfvpvesmettmraskkkk

Timeline for d1dxwa_:

• d1dxwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1dxwa_ appears in SCOP 1.67
  
• d1dxwa_ appears in SCOP 1.71
  
• d1dxwa_ appears in the current release, SCOPe 2.08, called d1dxwa1