Lineage for d1a1qb_ (1a1q B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 670182Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 670183Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 671537Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 671538Protein NS3 protease [50600] (3 species)
  7. 671544Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (14 PDB entries)
  8. 671567Domain d1a1qb_: 1a1q B: [26415]

Details for d1a1qb_

PDB Entry: 1a1q (more details), 2.4 Å

PDB Description: hepatitis c virus ns3 proteinase
PDB Compounds: (B:) ns3 proteinase

SCOP Domain Sequences for d1a1qb_:

Sequence, based on SEQRES records: (download)

>d1a1qb_ b.47.1.3 (B:) NS3 protease {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
pitaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgags
ktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgd
srgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettm

Sequence, based on observed residues (ATOM records): (download)

>d1a1qb_ b.47.1.3 (B:) NS3 protease {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
pitaysqgllgciitsltqvegevqvvstatqsflatcvngvcwtvyhgagsktlagpkg
pitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgdsrgsllsp
rpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettm

SCOP Domain Coordinates for d1a1qb_:

Click to download the PDB-style file with coordinates for d1a1qb_.
(The format of our PDB-style files is described here.)

Timeline for d1a1qb_: