SCOP 1.69: Domain d1a1qb_: 1a1q B:

Lineage for d1a1qb_ (1a1q B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (4 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein NS3 protease [50600] (2 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (11 PDB entries)

8. Domain d1a1qb_: 1a1q B: [26415]

Details for d1a1qb_

PDB Entry: 1a1q, 2.4 Å

PDB Description: hepatitis c virus ns3 proteinase

SCOP Domain Sequences for d1a1qb_:

Sequence, based on SEQRES records:

>d1a1qb_ b.47.1.3 (B:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
pitaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgags
ktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgd
srgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettm

Sequence, based on observed residues (ATOM records):

>d1a1qb_ b.47.1.3 (B:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
pitaysqgllgciitsltqvegevqvvstatqsflatcvngvcwtvyhgagsktlagpkg
pitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgdsrgsllsp
rpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettm

Timeline for d1a1qb_:

• d1a1qb_ first appeared (with stable ids) in SCOP 1.55
  
• d1a1qb_ appears in SCOP 1.67
  
• d1a1qb_ appears in SCOP 1.71
  
• d1a1qb_ appears in the current release, SCOPe 2.08