Lineage for d1a1qb_ (1a1q B:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 167857Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 167858Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 168698Family b.47.1.3: Viral proteases [50596] (2 proteins)
  6. 168699Protein NS3 protease [50600] (2 species)
  7. 168704Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (10 PDB entries)
  8. 168720Domain d1a1qb_: 1a1q B: [26415]

Details for d1a1qb_

PDB Entry: 1a1q (more details), 2.4 Å

PDB Description: hepatitis c virus ns3 proteinase

SCOP Domain Sequences for d1a1qb_:

Sequence, based on SEQRES records: (download)

>d1a1qb_ b.47.1.3 (B:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
pitaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgags
ktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgd
srgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettm

Sequence, based on observed residues (ATOM records): (download)

>d1a1qb_ b.47.1.3 (B:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
pitaysqgllgciitsltqvegevqvvstatqsflatcvngvcwtvyhgagsktlagpkg
pitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgdsrgsllsp
rpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettm

SCOP Domain Coordinates for d1a1qb_:

Click to download the PDB-style file with coordinates for d1a1qb_.
(The format of our PDB-style files is described here.)

Timeline for d1a1qb_: