SCOPe 2.06: Domain d4wsob_: 4wso B:

Lineage for d4wsob_ (4wso B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (50 species)
   not a true protein

7. Species Burkholderia thailandensis [TaxId:271848] [189811] (3 PDB entries)

8. Domain d4wsob_: 4wso B: [264141]
   automated match to d4wsoa_
   complexed with nad, po4

Details for d4wsob_

PDB Entry: 4wso, 2.05 Å

PDB Description: x-ray crystal structure of a nicotinate nucleotide adenylyltransferase from burkholderia thailandensis bound to nad

PDB Compounds: (B:) Probable nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d4wsob_:

Sequence; same for both SEQRES and ATOM records:

>d4wsob_ c.26.1.0 (B:) automated matches {Burkholderia thailandensis [TaxId: 271848]}
lpalprrigilggtfdpihdghlalarrfadvlrltelvlmpagqpyqkqdvsaaehrla
mtraaagslvlpgvavsvatdeiehagptytvetlerwrerlgadaslslligadqlvrl
dtwrdwrrlfdfahvcaatrpgfdfaaaspavaaeiasrqasadvlratpagrllidttl
aldvaatdirahlraciarhaqvpdasaehvspavwayilqhrlyhp

Timeline for d4wsob_:

• d4wsob_ first appeared in SCOPe 2.05
  
• d4wsob_ appears in SCOPe 2.07
  
• d4wsob_ appears in the current release, SCOPe 2.08