Class b: All beta proteins [48724] (149 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.3: Viral proteases [50596] (4 proteins) beta sheet in the first domain is opened rather than forms a barrel |
Protein NS3 protease [50600] (2 species) |
Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (14 PDB entries) |
Domain d1a1qa_: 1a1q A: [26414] |
PDB Entry: 1a1q (more details), 2.4 Å
SCOP Domain Sequences for d1a1qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a1qa_ b.47.1.3 (A:) NS3 protease {Human hepatitis C virus (HCV), different isolates} pitaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgags ktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgd srgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettmrs pvf
Timeline for d1a1qa_: