Lineage for d1a1qa_ (1a1q A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 376039Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 376040Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 377097Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 377098Protein NS3 protease [50600] (2 species)
  7. 377103Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (11 PDB entries)
  8. 377120Domain d1a1qa_: 1a1q A: [26414]

Details for d1a1qa_

PDB Entry: 1a1q (more details), 2.4 Å

PDB Description: hepatitis c virus ns3 proteinase

SCOP Domain Sequences for d1a1qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a1qa_ b.47.1.3 (A:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
pitaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgags
ktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgd
srgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettmrs
pvf

SCOP Domain Coordinates for d1a1qa_:

Click to download the PDB-style file with coordinates for d1a1qa_.
(The format of our PDB-style files is described here.)

Timeline for d1a1qa_: