![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.3: Viral proteases [50596] (4 proteins) beta sheet in the first domain is opened rather than forms a barrel |
![]() | Protein NS3 protease [50600] (2 species) |
![]() | Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (10 PDB entries) |
![]() | Domain d1ns3.2: 1ns3 B:,D: [26413] complexed with zn; mutant |
PDB Entry: 1ns3 (more details), 2.8 Å
SCOP Domain Sequences for d1ns3.2:
Sequence; same for both SEQRES and ATOM records: (download)
>g1ns3.2 b.47.1.3 (B:,D:) NS3 protease {Human hepatitis C virus (HCV), different isolates} itaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsk tlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgds rgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettmrXk gsvvivgriils
Timeline for d1ns3.2:
![]() Domains from other chains: (mouse over for more information) d1ns3.1, d1ns3.1, d1ns3.1, d1ns3.1 |