SCOP 1.57: Domain d1ns3.1: 1ns3 A:,C:

Lineage for d1ns3.1 (1ns3 A:,C:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (2 proteins)

6. Protein NS3 protease [50600] (2 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (10 PDB entries)

8. Domain d1ns3.1: 1ns3 A:,C: [26412]

Details for d1ns3.1

PDB Entry: 1ns3, 2.8 Å

PDB Description: structure of hcv protease (bk strain)

SCOP Domain Sequences for d1ns3.1:

Sequence; same for both SEQRES and ATOM records:

>g1ns3.1 b.47.1.3 (A:,C:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
itaysqqtrgllgciitsltgrdknqvegevqvvstatqsflatcvngvcwtvyhgagsk
tlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdlylvtrhadvipvrrrgds
rgsllsprpvsylkgssggpllcpsghavgifraavctrgvakavdfvpvesmettmrXk
gsvvivgriils

Timeline for d1ns3.1:

• d1ns3.1 first appeared (with stable ids) in SCOP 1.55
  
• d1ns3.1 appears in SCOP 1.59
  
• d1ns3.1 appears in the current release, SCOPe 2.08