Lineage for d1dy8.1 (1dy8 A:,C:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 466199Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 466200Protein NS3 protease [50600] (2 species)
  7. 466205Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (11 PDB entries)
  8. 466218Domain d1dy8.1: 1dy8 A:,C: [26410]

Details for d1dy8.1

PDB Entry: 1dy8 (more details), 2.4 Å

PDB Description: inhibition of the hepatitis c virus ns3/4a protease. the crystal structures of two protease-inhibitor complexes (inhibitor ii)

SCOP Domain Sequences for d1dy8.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dy8.1 b.47.1.3 (A:,C:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesmXgsvv
ivgriils

SCOP Domain Coordinates for d1dy8.1:

Click to download the PDB-style file with coordinates for d1dy8.1.
(The format of our PDB-style files is described here.)

Timeline for d1dy8.1: