![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.3: Viral proteases [50596] (5 proteins) beta sheet in the first domain is opened rather than forms a barrel |
![]() | Protein NS3 protease [50600] (5 species) |
![]() | Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (14 PDB entries) Uniprot P27958 1027-1206,1678-1669 Uniprot P26662 1029-1202,1677-1689 Uniprot O36579 1054-1207 |
![]() | Domain d1dy8.1: 1dy8 A:,C: [26410] complexed with 0f7 |
PDB Entry: 1dy8 (more details), 2.4 Å
SCOPe Domain Sequences for d1dy8.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1dy8.1 b.47.1.3 (A:,C:) NS3 protease {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesmXgsvv ivgriils
Timeline for d1dy8.1:
![]() Domains from other chains: (mouse over for more information) d1dy8.2, d1dy8.2, d1dy8.2, d1dy8.2 |