Lineage for d4w9lh_ (4w9l H:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2189359Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2189360Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2189361Family d.42.1.1: BTB/POZ domain [54696] (6 proteins)
  6. 2189438Protein Elongin C [54699] (3 species)
  7. 2189441Species Human (Homo sapiens) [TaxId:9606] [54700] (41 PDB entries)
  8. 2189474Domain d4w9lh_: 4w9l H: [264090]
    Other proteins in same PDB: d4w9la_, d4w9lc_, d4w9ld_, d4w9lf_, d4w9lg_, d4w9li_, d4w9lj_, d4w9lk2, d4w9ll_
    automated match to d4b9kb_
    complexed with 3jj

Details for d4w9lh_

PDB Entry: 4w9l (more details), 2.2 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-((S)-2-((S)-2-acetamido-3,3-dimethylbutanamido)-3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 15)
PDB Compounds: (H:) Transcription elongation factor B polypeptide 1

SCOPe Domain Sequences for d4w9lh_:

Sequence, based on SEQRES records: (download)

>d4w9lh_ d.42.1.1 (H:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy
ftykvrytnssteipefpiapeialellmaanfldc

Sequence, based on observed residues (ATOM records): (download)

>d4w9lh_ d.42.1.1 (H:) Elongin C {Human (Homo sapiens) [TaxId: 9606]}
myvklissdghefivkrehaltsgtikamlsgtnevnfreipshvlskvcmyftykvryt
nssteipefpiapeialellmaanfldc

SCOPe Domain Coordinates for d4w9lh_:

Click to download the PDB-style file with coordinates for d4w9lh_.
(The format of our PDB-style files is described here.)

Timeline for d4w9lh_: