Lineage for d4w9lg_ (4w9l G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931223Protein Elongin B [54246] (2 species)
  7. 2931224Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries)
  8. 2931262Domain d4w9lg_: 4w9l G: [264089]
    Other proteins in same PDB: d4w9lb_, d4w9lc_, d4w9le_, d4w9lf_, d4w9lh_, d4w9li_, d4w9lk1, d4w9lk2, d4w9ll_
    automated match to d1lqba_
    complexed with 3jj

Details for d4w9lg_

PDB Entry: 4w9l (more details), 2.2 Å

PDB Description: pVHL:EloB:EloC in complex with (2S,4R)-1-((S)-2-((S)-2-acetamido-3,3-dimethylbutanamido)-3,3-dimethylbutanoyl)-4-hydroxy-N-(4-(4-methylthiazol-5-yl)benzyl)pyrrolidine-2-carboxamide (ligand 15)
PDB Compounds: (G:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d4w9lg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4w9lg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d4w9lg_:

Click to download the PDB-style file with coordinates for d4w9lg_.
(The format of our PDB-style files is described here.)

Timeline for d4w9lg_: