SCOP 1.61: Domain d1cu1a1: 1cu1 A:705-720,A:3-186

Lineage for d1cu1a1 (1cu1 A:705-720,A:3-186)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (2 proteins)

6. Protein NS3 protease [50600] (2 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (10 PDB entries)

8. Domain d1cu1a1: 1cu1 A:705-720,A:3-186 [26408]
   Other proteins in same PDB: d1cu1a2, d1cu1a3, d1cu1b2, d1cu1b3

Details for d1cu1a1

PDB Entry: 1cu1, 2.5 Å

PDB Description: crystal structure of an enzyme complex from hepatitis c virus

SCOP Domain Sequences for d1cu1a1:

Sequence; same for both SEQRES and ATOM records:

>d1cu1a1 b.47.1.3 (A:705-720,A:3-186) NS3 protease {Human hepatitis C virus (HCV), different isolates}
gsvvivgriilsgsgsXitaysqqtrgllgciitsltgrdknqvegevqvvstatqsfla
tcvngvcwtvyhgagsktlagpkgpitqmytnvdqdlvgwqappgarsltpctcgssdly
lvtrhadvipvrrrgdsrgsllsprpvsylkgssggpllcpsghavgifraavctrgvak
avdfvpvesmettmrspvftd

Timeline for d1cu1a1:

• d1cu1a1 first appeared (with stable ids) in SCOP 1.55
  
• d1cu1a1 appears in SCOP 1.59
  
• d1cu1a1 appears in SCOP 1.63
  
• d1cu1a1 appears in the current release, SCOPe 2.08