Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Elongin C [54699] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries) |
Domain d4w9ih_: 4w9i H: [264073] Other proteins in same PDB: d4w9ia_, d4w9ic_, d4w9id_, d4w9if_, d4w9ig_, d4w9ii_, d4w9ij_, d4w9ik2, d4w9il_ automated match to d4b9kb_ complexed with 3js |
PDB Entry: 4w9i (more details), 2.4 Å
SCOPe Domain Sequences for d4w9ih_:
Sequence, based on SEQRES records: (download)
>d4w9ih_ d.42.1.1 (H:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d4w9ih_ d.42.1.1 (H:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgtnevnfreipshvlskvcmyftykvryt nssteipefpiapeialellmaanfldc
Timeline for d4w9ih_: