Lineage for d1a1r.2 (1a1r B:,D:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 230291Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 230292Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 231168Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 231169Protein NS3 protease [50600] (2 species)
  7. 231174Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (10 PDB entries)
  8. 231180Domain d1a1r.2: 1a1r B:,D: [26407]
    complexed with zn; mutant

Details for d1a1r.2

PDB Entry: 1a1r (more details), 2.5 Å

PDB Description: hcv ns3 protease domain:ns4a peptide complex

SCOP Domain Sequences for d1a1r.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1a1r.2 b.47.1.3 (B:,D:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
pitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcingvcwtvyhgagt
rtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtrhadvipvrrrgd
srgsllsprpisylkgssggpllcptghavglfraavctrgvakavdfipvenlettmrX
kgsvvivgrivlsgkpaiipk

SCOP Domain Coordinates for d1a1r.2:

Click to download the PDB-style file with coordinates for d1a1r.2.
(The format of our PDB-style files is described here.)

Timeline for d1a1r.2: