SCOP 1.59: Domain d1a1r.2: 1a1r B:,D:

Lineage for d1a1r.2 (1a1r B:,D:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (2 proteins)

6. Protein NS3 protease [50600] (2 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (10 PDB entries)

8. Domain d1a1r.2: 1a1r B:,D: [26407]

Details for d1a1r.2

PDB Entry: 1a1r, 2.5 Å

PDB Description: hcv ns3 protease domain:ns4a peptide complex

SCOP Domain Sequences for d1a1r.2:

Sequence; same for both SEQRES and ATOM records:

>g1a1r.2 b.47.1.3 (B:,D:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
pitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcingvcwtvyhgagt
rtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtrhadvipvrrrgd
srgsllsprpisylkgssggpllcptghavglfraavctrgvakavdfipvenlettmrX
kgsvvivgrivlsgkpaiipk

Timeline for d1a1r.2:

• d1a1r.2 first appeared (with stable ids) in SCOP 1.55
  
• d1a1r.2 appears in SCOP 1.57
  
• d1a1r.2 appears in SCOP 1.61
  
• d1a1r.2 appears in the current release, SCOPe 2.08