Lineage for d1a1r.2 (1a1r B:,D:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 15540Family b.47.1.3: Viral proteases [50596] (2 proteins)
  6. 15541Protein NS3 protease [50600] (2 species)
  7. 15546Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (10 PDB entries)
  8. 15552Domain d1a1r.2: 1a1r B:,D: [26407]

Details for d1a1r.2

PDB Entry: 1a1r (more details), 2.5 Å

PDB Description: hcv ns3 protease domain:ns4a peptide complex

SCOP Domain Sequences for d1a1r.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1a1r.2 b.47.1.3 (B:,D:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
pitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcingvcwtvyhgagt
rtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtrhadvipvrrrgd
srgsllsprpisylkgssggpllcptghavglfraavctrgvakavdfipvenlettmrX
kgsvvivgrivlsgkpaiipk

SCOP Domain Coordinates for d1a1r.2:

Click to download the PDB-style file with coordinates for d1a1r.2.
(The format of our PDB-style files is described here.)

Timeline for d1a1r.2: