Lineage for d1a1r.1 (1a1r A:,C:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 561477Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 561478Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 562627Family b.47.1.3: Viral proteases [50596] (4 proteins)
    beta sheet in the first domain is opened rather than forms a barrel
  6. 562628Protein NS3 protease [50600] (2 species)
  7. 562633Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (14 PDB entries)
  8. 562642Domain d1a1r.1: 1a1r A:,C: [26406]

Details for d1a1r.1

PDB Entry: 1a1r (more details), 2.5 Å

PDB Description: hcv ns3 protease domain:ns4a peptide complex

SCOP Domain Sequences for d1a1r.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1a1r.1 b.47.1.3 (A:,C:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
vegevqivstatqtflatcingvcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpap
qgsrsltpctcgssdlylvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcptg
havglfraavctrgvakavdfipvenlettmrXgsvvivgrivlsgkpa

SCOP Domain Coordinates for d1a1r.1:

Click to download the PDB-style file with coordinates for d1a1r.1.
(The format of our PDB-style files is described here.)

Timeline for d1a1r.1: