![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein Elongin B [54246] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54247] (49 PDB entries) |
![]() | Domain d4w9gg_: 4w9g G: [264056] Other proteins in same PDB: d4w9gb_, d4w9gc_, d4w9ge_, d4w9gf_, d4w9gh_, d4w9gi_, d4w9gk1, d4w9gk2, d4w9gl_ automated match to d1lqba_ complexed with 3jv |
PDB Entry: 4w9g (more details), 2.7 Å
SCOPe Domain Sequences for d4w9gg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4w9gg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec gftsqtarpqapatvglafraddtfealciepfssppelpdvm
Timeline for d4w9gg_: