![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
![]() | Superfamily d.42.1: POZ domain [54695] (3 families) ![]() |
![]() | Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
![]() | Protein Elongin C [54699] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54700] (30 PDB entries) |
![]() | Domain d4w9gb_: 4w9g B: [264053] Other proteins in same PDB: d4w9ga_, d4w9gc_, d4w9gd_, d4w9gf_, d4w9gg_, d4w9gi_, d4w9gj_, d4w9gl_ automated match to d4b9kb_ complexed with 3jv |
PDB Entry: 4w9g (more details), 2.7 Å
SCOPe Domain Sequences for d4w9gb_:
Sequence, based on SEQRES records: (download)
>d4w9gb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d4w9gb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsnevnfreipshvlskvcmyftykvrytns steipefpiapeialellmaanfldc
Timeline for d4w9gb_: