SCOP 1.73: Domain d1dxp.2: 1dxp B:,D:

Lineage for d1dxp.2 (1dxp B:,D:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.3: Viral proteases [50596] (4 proteins)
   beta sheet in the first domain is opened rather than forms a barrel

6. Protein NS3 protease [50600] (3 species)

7. Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (14 PDB entries)

8. Domain d1dxp.2: 1dxp B:,D: [26405]
   complexed with gol, zn

Details for d1dxp.2

PDB Entry: 1dxp, 2.4 Å

PDB Description: inhibition of the hepatitis c virus ns3/4a protease. the crystal structures of two protease-inhibitor complexes (apo structure)

PDB Compounds: (B:) protease/helicase ns3 (p70), (D:) nonstructural protein ns4a (p4)

SCOP Domain Sequences for d1dxp.2:

Sequence; same for both SEQRES and ATOM records:

>g1dxp.2 b.47.1.3 (B:,D:) NS3 protease {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}
apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesmXgsvv
ivgriils

Timeline for d1dxp.2:

• d1dxp.2 first appeared (with stable ids) in SCOP 1.55
  
• d1dxp.2 appears in SCOP 1.71
  
• d1dxp.2 appears in SCOP 1.75
  
• d1dxp.2 appears in the current release, SCOPe 2.08