Lineage for d1dxp.2 (1dxp B:,D:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 112384Family b.47.1.3: Viral proteases [50596] (2 proteins)
  6. 112385Protein NS3 protease [50600] (2 species)
  7. 112390Species Human hepatitis C virus (HCV), different isolates [TaxId:11103] [50601] (10 PDB entries)
  8. 112398Domain d1dxp.2: 1dxp B:,D: [26405]

Details for d1dxp.2

PDB Entry: 1dxp (more details), 2.4 Å

PDB Description: inhibition of the hepatitis c virus ns3/4a protease. the crystal structures of two protease-inhibitor complexes (apo structure)

SCOP Domain Sequences for d1dxp.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1dxp.2 b.47.1.3 (B:,D:) NS3 protease {Human hepatitis C virus (HCV), different isolates}
apitaysqqtrgllgciitsltgrdknqvdgevqvlstatqsflatcvngvcwtvyhgag
sktlagpkgpitqmytnvdqdlvgwpappgarsmtpctcgssdlylvtrhadvipvrrrg
dsrgsllsprpvsylkgssggpllcpsghvvgifraavctrgvakavdfipvesmXgsvv
ivgriils

SCOP Domain Coordinates for d1dxp.2:

Click to download the PDB-style file with coordinates for d1dxp.2.
(The format of our PDB-style files is described here.)

Timeline for d1dxp.2: